PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28650.m000187
Common NameLOC8287880, RCOM_0300300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 688aa    MW: 78173.8 Da    PI: 6.7509
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28650.m000187genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3958e-1213146842374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL +cA+ vs +d++ a++lL ++++++sp+gd +qRla+yf++AL++rla++++  y+ l +s+t+   +s+ l+a++++++++P+ ++s++ 
  28650.m000187 314 STLLAQCAQSVSISDHRTATELLRQIRQHSSPYGDGNQRLAHYFANALETRLAGTGTPAYSPLLSSKTP---VSDILKAYQVYVKACPFKRMSNFF 406
                    579*********************************************************999999998...9*********************** PP

           GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                    aNq+I + +e+++r+HiiDf++ +G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+rL++++e+++vpf++++ va+++e++++
  28650.m000187 407 ANQTIFKLAEKATRLHIIDFGVLYGFQWPCLIQRLSQRPGGPPKLRITGIELPQPGfrPAERVEETGRRLQRYCERFNVPFKYHA-VAQKWETIKY 501
                    *******************************************************9*****************************.7********* PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                    e+L++++gE+++Vn+ ++l +l+d++v  +s+rd+vLkl+++++P+++++   +  +n++ F++rf eal yysalfd++e ++pre+++r+ +E+
  28650.m000187 502 EDLNIDRGEMTVVNCLYRLRNLPDDTVVANSARDAVLKLIRKIRPDIFIHGVINGTYNAPFFVTRFREALFYYSALFDMFEINVPREDDQRMLYEK 597
                    ************************************************************************************************ PP

           GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +++gr+i+nv+acegaer+er et+++W+ r  +aGF++++l++++ k++++ +r  + + + v+e+  ++++gWk+r + ++S+W+
  28650.m000187 598 AIFGRDIMNVIACEGAERVERPETYKQWQVRNLRAGFRQLSLDQEILKKVRCTVRSEYHKDFVVDENGRWMLQGWKGRVISALSVWK 684
                    *********************************************************9888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.804287664IPR005202Transcription factor GRAS
PfamPF035142.8E-118314684IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MDTLLQEFPN TMNRFKFDHG PISFPSNRNL LNGYELNHNL SNPISNLPFL SFNSQAPNDL  60
TQSSPSSSEG HDPNNNAVLK YISDMLMEED LEGKTCMLQD CLALQAAEKS LYDVLGQEYP  120
HSLSHCPQIV GSPDDNSLWS SSFDRRNCYP GAVNSSVEKP SWTLDQIHNL DLYSTLTGPD  180
FHSVRQGIGD ASKFFSDGDP LVVAPNSSSP TCSDKEESDY SPSSSRGRKN HQREDSDYLE  240
EEEERSNKHS ALSLAESEQS EMFDEVLLCP SGKHESETCA FQDKSRNGAS LKGSNGRTAR  300
GRRQGNKGEV VDLSTLLAQC AQSVSISDHR TATELLRQIR QHSSPYGDGN QRLAHYFANA  360
LETRLAGTGT PAYSPLLSSK TPVSDILKAY QVYVKACPFK RMSNFFANQT IFKLAEKATR  420
LHIIDFGVLY GFQWPCLIQR LSQRPGGPPK LRITGIELPQ PGFRPAERVE ETGRRLQRYC  480
ERFNVPFKYH AVAQKWETIK YEDLNIDRGE MTVVNCLYRL RNLPDDTVVA NSARDAVLKL  540
IRKIRPDIFI HGVINGTYNA PFFVTRFREA LFYYSALFDM FEINVPREDD QRMLYEKAIF  600
GRDIMNVIAC EGAERVERPE TYKQWQVRNL RAGFRQLSLD QEILKKVRCT VRSEYHKDFV  660
VDENGRWMLQ GWKGRVISAL SVWKPVQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-453176848375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533749.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9T6800.0B9T680_RICCO; Transcription factor, putative
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14